SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331659|ref|NP_442387.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331659|ref|NP_442387.1|
Domain Number 1 Region: 177-388
Classification Level Classification E-value
Superfamily Radical SAM enzymes 6.02e-34
Family Oxygen-independent coproporphyrinogen III oxidase HemN 0.044
Further Details:      
 
Domain Number 2 Region: 26-150
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 0.0000889
Family Cobalamin (vitamin B12)-binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16331659|ref|NP_442387.1|
Sequence length 499
Comment Mg-protoporphyrin IX monomethyl ester oxidative cyclase 66 kD subunit [Synechocystis sp. PCC 6803]
Sequence
MRILILNPPHPAIGSRIPKEQLPPLGLLSIGGPLLDAGHDVTLLDAEFGPLTDSEIVERV
CAHCPQLLLIGHSGSTSAHPIVCRLTLFLRERLPNLIIVYGGVFPTYHFHDILTKEPQID
FIVRGEGEATVAKLIAALENHNDLNKVDGIAFRRDEQIIETLPAPMIQDLDVYRVGWELV
DLKKYSYYGGKQAVVIQFSRGCPHLCNYCGQRGFWARWRHRDPKKFAQEIVWLHRTHGVQ
LFNLADENPTVNKAIWQEFCEAIIAENISITIIGSTRADDIVRDADILHLYRRAGVERFL
LGMENTNEATLKHIRKGSKTSTDREAIRLLRQHNILSLATWVTDFEEVRDRDFIQALKQL
LYYDPDQIMSLYVTPHRWTSFYGIASERRVIQLDQTKWDYKHQVLAATHMPPWRIFLWVK
LIEILLQTRPKALWRLLFQPNKASRRGMYWFTLMGRRVLVHELINFFFGDRRVKNGPTLQ
EFWGMPQEHQEIPLSITRK
Download sequence
Identical sequences Q55373
gi|383492454|ref|YP_005410131.1| gi|383326570|ref|YP_005387424.1| 1148.slr0905 gi|383323401|ref|YP_005384255.1| WP_010873684.1.11876 WP_010873684.1.1889 WP_010873684.1.18904 WP_010873684.1.33690 WP_010873684.1.35395 WP_010873684.1.47586 WP_010873684.1.99424 gi|16331659|ref|NP_442387.1| gi|16331659|ref|NP_442387.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]