SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331712|ref|NP_442440.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331712|ref|NP_442440.1|
Domain Number 1 Region: 38-273
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.24e-72
Family Alanine racemase-like, N-terminal domain 0.0000139
Further Details:      
 
Domain Number 2 Region: 266-399
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.64e-46
Family Alanine racemase 0.0000965
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16331712|ref|NP_442440.1|
Sequence length 400
Comment alanine racemase [Synechocystis sp. PCC 6803]
Sequence
MVLSRDVKSSPEQASRVSSTLSGYRLAELIRQRAWVEIDQAALVHNVRQFRQYVGPKTNL
MAVVKADAYGHGAVRVAQTALQAGADWLAIATLGEGIELREAGITAPILLLGGINSPEEI
EAIAHWRLQPTLCSPEQAQLFNDILLKLGKVLPVHLKLDTGMTRLGTPWPQAANFVGLVQ
SLPQLRLASLYSHLATADDPNTATMLQQQERFAKAIASLRQARLPIPKLHLANSAATLHG
QAWHYDMVRVGLGLYGLYPAPHLGDCLDLKPVLTVRAKITQIRTIPPGTGVSYGHQFVSE
ETMPMAVVGIGYADGVPRNLSNQLEVLLRGQPVRQIGAITMDQMMVDLRGIDDPQVGEVV
TLIGQDGDRQITADHWASTLGTISWEILCGFKHRLPRILI
Download sequence
Identical sequences L8APH4
gi|383326624|ref|YP_005387478.1| 1148.slr0827 gi|16331712|ref|NP_442440.1| gi|383492508|ref|YP_005410185.1| gi|16331712|ref|NP_442440.1| WP_010873738.1.11876 WP_010873738.1.1889 WP_010873738.1.18904 WP_010873738.1.33690 WP_010873738.1.35395 WP_010873738.1.47586 WP_010873738.1.99424 NYSGRC-FDAO-BAA10510 gi|383323455|ref|YP_005384309.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]