SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331718|ref|NP_442446.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331718|ref|NP_442446.1|
Domain Number 1 Region: 380-502,745-809
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.24e-47
Family Intein (protein splicing domain) 0.00000221
Further Details:      
 
Domain Number 2 Region: 181-365,804-867
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.99e-38
Family RecA protein-like (ATPase-domain) 0.072
Further Details:      
 
Domain Number 3 Region: 7-117
Classification Level Classification E-value
Superfamily N-terminal domain of DnaB helicase 1.57e-32
Family N-terminal domain of DnaB helicase 0.00024
Further Details:      
 
Domain Number 4 Region: 579-690
Classification Level Classification E-value
Superfamily Homing endonucleases 1.87e-16
Family Intein endonuclease 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16331718|ref|NP_442446.1|
Sequence length 872
Comment replicative DNA helicase [Synechocystis sp. PCC 6803]
Sequence
MAANPALPPQNIEAEECILGGILLDPEAMGRIIDLLVVDAFYVKAHRLIYEAMLSLHGQS
QPTDLMSVSSWLQDHHHFEAIGGMVKLTQLLDRTISAVNIDRFAALIMDKYLRRQLIAAG
HDIVDLGYETSKELETIFDESEQKIFRLTQSRPQAGLVPLSETLVNTFIELDKLHEKLSS
PGVETQFYDLDAMTGGLQRADLIILAGRPSMGKTAFGLGIAANIAKNQNLPVAIFSLEMS
KEQLALRLVASESLIDSNRLRTGHFSQAEFEPLTAAMGTLSSLPIYIDDTASISVTQMRS
QVRRLQSEQKGPLGMVLIDYLQLMEGGSDNRVQELSKITRSLKGLAREINAPVIALSQLS
RAVESRTNKRPMMSDLRESGCISGDSLISLASTGKRVSIKDLLDEKDFEIWAINEQTMKL
ESAKVSRVFCTGKKLVYILKTRLGRTIKATANHRFLTIDGWKRLDELSLKEHIALPRKLE
SSSLQLMSDEELGLLGHLIGDGCTLPRHAIQYTSNKIELAEKVVELAKAVFGDQINPRIS
QERQWYQVYIPASYRLTHNKKNPITKWLENLDVFGLRSYEKFVPNQVFEQPQRAIAIFLR
HLWSTDGCVKLIVEKSSRPVAYYATSSEKLAKDVQSLLLKLGINARLSKISQNGKGRDNY
HVTITGQADLQIFVDQIGAVDKDKQASVEEIKTHIAQHQANTNRDVIPKQIWKTYVLPQI
QIKGITTRDLQMRLGNAYCGTALYKHNLSRERAAKIATITQSPEIEKLSQSDIYWDSIVS
ITETGVEEVFDLTVPGPHNFVANDIIVHNSIEQDADLIMMIYRDEYYNPDTPDPGVAELL
IVKHRNGPTGVVKLLFKPEFTQFLNLQRSNDY
Download sequence
Identical sequences L8AMI5 Q55418
gi|383326630|ref|YP_005387484.1| gi|383492514|ref|YP_005410191.1| 1148.slr0833 gi|16331718|ref|NP_442446.1| gi|16331718|ref|NP_442446.1| WP_010873744.1.11876 WP_010873744.1.1889 WP_010873744.1.18904 WP_010873744.1.33690 WP_010873744.1.35395 WP_010873744.1.47586 WP_010873744.1.99424 gi|383323461|ref|YP_005384315.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]