SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331736|ref|NP_442464.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|16331736|ref|NP_442464.1|
Domain Number - Region: 80-122
Classification Level Classification E-value
Superfamily AbrB/MazE/MraZ-like 0.00645
Family Kis/PemI addiction antidote 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16331736|ref|NP_442464.1|
Sequence length 129
Comment hypothetical protein sll0822 [Synechocystis sp. PCC 6803]
Sequence
MAKSNATKPLTGEALLEKVKELGDLPKEEKAKICGYVTSTKKGLPRVNMMKFYNALMDAQ
GIDLDSSASGQGRGGRSASYRISVQSNGNLLIGAAYTKKMSLNVGDEFEITLGRKHIHLK
QVGADDEEE
Download sequence
Identical sequences L8AQV9 Q55432
gi|383323479|ref|YP_005384333.1| gi|16331736|ref|NP_442464.1| WP_010873762.1.11876 WP_010873762.1.1889 WP_010873762.1.18904 WP_010873762.1.33690 WP_010873762.1.35395 WP_010873762.1.47586 WP_010873762.1.99424 1148.sll0822 gi|383326648|ref|YP_005387502.1| gi|16331736|ref|NP_442464.1| gi|383492532|ref|YP_005410209.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]