SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331753|ref|NP_442481.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331753|ref|NP_442481.1|
Domain Number 1 Region: 233-634
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.33e-50
Family RecA protein-like (ATPase-domain) 0.00000763
Further Details:      
 
Domain Number 2 Region: 12-170
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.00000000000243
Family GSPII protein E N-terminal domain-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16331753|ref|NP_442481.1|
Sequence length 813
Comment general secretion pathway protein E [Synechocystis sp. PCC 6803]
Sequence
MVFSSDSPEFSLSPFEQALIEAGYLSLSQIHQALMEARRTGIALPTLVETILGESLPDEL
HRQYQAQQRFALSVIHGVKFFDQHQLTTLANTEAIASLLNRYFPLPICRQYGFLPLHYRE
NPGALLVVMVDPSDPEASQFLQRQLAPHRLTLRRRGVTKDDFDNLIDQLYHDPEVQAALN
AHRQTEISEDPYDGKATVVEVTEIIEDLPQQIAALQNTPPVAPPPVSAIAENTNDSNPEA
KSEGPEVKLANKILILGLREGASEIHIDPQDNRVLVQIRQGGNLRMLLEPLPRELGPKLV
ARVKTMAHLDTSQTNIPQKARIRKSYNGQSVFFYVNILPSFYGEKILVRVVPHLEKLPDF
AQLCGDRQSQESLQRLAQESQGLVVVIGAAYGGKTTTMEAFLGQQLDQNRSVALVSDPLV
HVYENINQLEVNPQKDFTSEKAVQSLQDQWPAVMAVDPLEDQETAQILTQVLNQGHLVFT
SVIAKDVPSAIAQLQQWFEPAVLGQHLKGIVSQRPVRRVCPACRLRGEVTPEEQQRFGLP
PGTIYRANSLSMELMAQPMIKSRLCRQCHGLGYSGMTGIFEVVAITPELQQLVSSPCSHA
EIINGLSQAGIASPARQAITLVSQGVTTLEEVTRLFPQLPRQLSPRSSPPEAISAQSSPM
TPPATQTIPGETMFSDDQWWQRLQQLEKSVQELNRALADLKKMAGDRPSAHRTRAGDHHS
PSAAGPNLDLMAELQALEDLSAHKRPKARDRHEQAVTVMEGFDQIEELLIDDQLGQPAAA
PFNAGEETFIAEEEANVPEGKKFNPFKSVIDPW
Download sequence
Identical sequences L8AMF1 Q55799
gi|383323496|ref|YP_005384350.1| gi|383326665|ref|YP_005387519.1| gi|16331753|ref|NP_442481.1| gi|16331753|ref|NP_442481.1| WP_010873779.1.11876 WP_010873779.1.1889 WP_010873779.1.33690 WP_010873779.1.35395 WP_010873779.1.47586 WP_010873779.1.99424 1148.slr0079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]