SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331757|ref|NP_442485.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331757|ref|NP_442485.1|
Domain Number 1 Region: 129-366
Classification Level Classification E-value
Superfamily Radical SAM enzymes 1.44e-53
Family MoCo biosynthesis proteins 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16331757|ref|NP_442485.1|
Sequence length 443
Comment hypothetical protein slr0082 [Synechocystis sp. PCC 6803]
Sequence
MGQTPTIAINHLGCEKNRIDSEHMLGLLVEAGYQVDANEELADYVIVNTCSFIQDARQES
VRTLVELAEAKKKIVISGCLAQHFQEQLLEEIPEAVAVVGTGDYQNIVDIIRRTEQGQRV
KAISPNPSFIADENLPRYRTTNEAIAYLRVAEGCDYRCAFCIIPQLRGKQRSRPIESIVA
EAEQLASQGVKELILISQITTNYGLDLYGEPKLAELLQALGKVDIPWIRIHYAYPTGLTP
KVIEAIRDTPNVLPYLDLPLQHSHPDILRAMNRPWQGQVNDDIITRLKTALPDAVLRTTF
IVGFPGETEEHFGHLLDFVQRHQFDHVGVFTFSPEEGTAAFDLPNAVPEEVMGDRRDRLM
ALQQPISAQKNAACLGQTLDVLIEQENPSTGEFIGRSTRFAPEVDGLVYVKGNANLNEIV
PVVITATDDYDLYGMTAEEAKVF
Download sequence
Identical sequences L8APC9 Q55803
SgR216 gi|16331757|ref|NP_442485.1| WP_010873783.1.11876 WP_010873783.1.1889 WP_010873783.1.18904 WP_010873783.1.33690 WP_010873783.1.35395 WP_010873783.1.47586 WP_010873783.1.99424 gi|383326669|ref|YP_005387523.1| gi|16331757|ref|NP_442485.1| 1148.slr0082 gi|383492553|ref|YP_005410230.1| gi|383323500|ref|YP_005384354.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]