SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331787|ref|NP_442515.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331787|ref|NP_442515.1|
Domain Number 1 Region: 332-459
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.17e-27
Family cAMP-binding domain 0.0078
Further Details:      
 
Domain Number 2 Region: 208-303
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 3.01e-23
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0035
Further Details:      
 
Domain Number 3 Region: 137-201
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.0000000000000203
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0031
Further Details:      
 
Domain Number 4 Region: 52-134
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.00000000575
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16331787|ref|NP_442515.1|
Sequence length 505
Comment hypothetical protein slr0510 [Synechocystis sp. PCC 6803]
Sequence
MIAQINPPPQGPGPQAIANVLEQWHFLNIWLFETLNTPIFKLGTESITLWWIIQACFLLL
LVGVFAKATKQFLKKFLLLKLRFSEGNREVIGTLTSLGVAVLGFIVVLQAMGLELASFAV
IMGGLGIGIGFGLQELTRNLVSGLTIFGENKLKVGDLIEFNNHIGYIKEISIRSTIIRTF
RGSDLVVPNTDLTSNLVVNWNYENCSGRLEVPVSVEYGSDLVLVTEVLLESAAMEKNIVS
EPAPKAVFLGFGDNSLNFELWVWTERIDQRFLIFSSLNHIIQYNCRRRGINMPFPQRDIW
LRNPESICLAVSDQDNNATVPGKEVGESPTLTQLLKKNFCFQKLNDLEIRNVIEMGKRWH
LQPGEILIKQNQYHSYFCIVLTGAIDAIYENEKISNRIFTFKQGEFFGELPLMLEIPYPT
TMIAAEDSTLFLIGKDCFHILLANHPQLSNLVAEELGKRQDALQGYEQKLKEMGLLEEAD
LKNPVEWIRQRINKIFGVSQESAYR
Download sequence
Identical sequences L8AP95 Q55830
gi|383323530|ref|YP_005384384.1| 1148.slr0510 gi|383326699|ref|YP_005387553.1| WP_010873813.1.11876 WP_010873813.1.1889 WP_010873813.1.18904 WP_010873813.1.33690 WP_010873813.1.35395 WP_010873813.1.47586 WP_010873813.1.99424 gi|16331787|ref|NP_442515.1| gi|16331787|ref|NP_442515.1| gi|383492583|ref|YP_005410260.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]