SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331817|ref|NP_442545.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331817|ref|NP_442545.1|
Domain Number 1 Region: 9-67,97-426
Classification Level Classification E-value
Superfamily Clc chloride channel 6.67e-36
Family Clc chloride channel 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16331817|ref|NP_442545.1|
Sequence length 451
Comment hypothetical protein slr0617 [Synechocystis sp. PCC 6803]
Sequence
MINGKPQPLLTRVGTWTVGGLLGGLIGSLAAVMLTESIKQTLSVISGLDPIWLLLIPLFG
VALAVLVLFGLGKGQPVQTVAPREANTPGRWGSLLSWYSFPHDIARADLTGDVVNASGVE
ERFPWNLAPLRAIAILSTVGFGAPMGTESPAAHIGFATGTWLGSVNSALRPLVRPLAIGG
GAASVSALMGIPLVGSFFMFELSGRRQIPLTPERGAAMLAGGLVGWGINVAFNLQLIRLV
VPKVPPADLWNAMGATLFIGVVTGTITALTGEAIYWARGLRTKPAIRLLAGSLAMLLLAV
AIAQIATPAAAFGPGGAAIVWAENIETTPYHLLAVAILRAASTTAAVLAGGCGGVFVPFL
AIGDLTGRVFATIFGISGDLAGAAGAAAGIAGGYRLPLTAVAMVLGVGGPETAQITCLGT
VVIAAFSGLLAARLANQVSSAIRTIGARNHG
Download sequence
Identical sequences L8AM88 Q55858
1148.slr0617 WP_010873843.1.11876 WP_010873843.1.1889 WP_010873843.1.18904 WP_010873843.1.33690 WP_010873843.1.35395 WP_010873843.1.47586 WP_010873843.1.99424 gi|383323560|ref|YP_005384414.1| gi|16331817|ref|NP_442545.1| gi|383492613|ref|YP_005410290.1| gi|383326729|ref|YP_005387583.1| gi|16331817|ref|NP_442545.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]