SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331842|ref|NP_442570.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331842|ref|NP_442570.1|
Domain Number 1 Region: 2-197,298-389
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 8.98e-81
Family Bacterial dinuclear zinc exopeptidases 0.0000192
Further Details:      
 
Domain Number 2 Region: 185-291
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 2.49e-30
Family Bacterial exopeptidase dimerisation domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16331842|ref|NP_442570.1|
Sequence length 393
Comment N-acyl-L-amino acid amidohydrolase [Synechocystis sp. PCC 6803]
Sequence
MELKNLAQTLLPRLVEIRRHLHAHPELSGQEYQTAAYVAGVLSSCGLHVEEAIGKTGVVG
QLSGKGDDPRLLAIRTDMDALPIEEMVSLPFASRHPGVMHACGHDIHTTLGLGTAMVLSQ
MGHRLPGDVRFLFQPAEEIAQGASWMIQDGAMKGVSHILGVHVFPSIPAQQVGIRYGALT
AAADDLEIFIQGESGHGARPHEAIDAIWIAAQVITALQQAISRTQNPLRPMVLSLGQISG
GRAPNVIADQVRMAGTVRSLHPETHAQLPQWIEGIVANVCQTYGAKYEVNYRRGVPSVQN
DAQLNKLLENAVREAWGESALQIIPEPSLGAEDFALYLEHAPGAMFRLGTGFGDRQMNHP
LHHPRFEADEAAILTGVVTLSYAAWQYWQNIAI
Download sequence
Identical sequences P54984
1148.sll0100 gi|16331842|ref|NP_442570.1| gi|383323585|ref|YP_005384439.1| gi|383326754|ref|YP_005387608.1| WP_010873868.1.11876 WP_010873868.1.1889 WP_010873868.1.18904 WP_010873868.1.33690 WP_010873868.1.35395 WP_010873868.1.47586 WP_010873868.1.99424 gi|383492638|ref|YP_005410315.1| gi|16331842|ref|NP_442570.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]