SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331844|ref|NP_442572.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331844|ref|NP_442572.1|
Domain Number 1 Region: 102-318
Classification Level Classification E-value
Superfamily Radical SAM enzymes 0.00000000000000206
Family MoCo biosynthesis proteins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16331844|ref|NP_442572.1|
Sequence length 350
Comment hypothetical protein sll0098 [Synechocystis sp. PCC 6803]
Sequence
MAPSPAPLLSLSLPELTDWVQTTGQPAYRGKQIHQWLYQKGARSLTAMTDLPKVWREKNV
HYPIGRSVIDHCAVAPDHTRKYLLRLADGLIIETVGIPSSKRLTVCVSSQVGCAMDCNFC
ATGKGGFIRNLESHEIVDQVLTVQEEFHERVSNVVFMGMGEPLLNLPQVVKAVECLNQVV
GIGQRALTISTVGLPGKIRQLADRHLQVTFAVSLHAPNQTLRQSLIPSARHYPLEQLLAD
CRAYVETTGRRVTFEYVLLAGVNDQPVHAEELAQKLRGFQTHVNLIPYNPISEVDYQRPT
EAQINQFAQVLSDHRIAVSVRYSRGVQADAACGQLRASRKEELAELTPMA
Download sequence
Identical sequences Q55880
gi|383323587|ref|YP_005384441.1| gi|16331844|ref|NP_442572.1| gi|16331844|ref|NP_442572.1| gi|383326756|ref|YP_005387610.1| 1148.sll0098 gi|383492640|ref|YP_005410317.1| WP_010873870.1.11876 WP_010873870.1.1889 WP_010873870.1.18904 WP_010873870.1.33690 WP_010873870.1.35395 WP_010873870.1.47586 WP_010873870.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]