SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331846|ref|NP_442574.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331846|ref|NP_442574.1|
Domain Number 1 Region: 150-215
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.000000000000458
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0035
Further Details:      
 
Weak hits

Sequence:  gi|16331846|ref|NP_442574.1|
Domain Number - Region: 65-149
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.000103
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.011
Further Details:      
 
Domain Number - Region: 228-307
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.000106
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16331846|ref|NP_442574.1|
Sequence length 318
Comment hypothetical protein slr0109 [Synechocystis sp. PCC 6803]
Sequence
MMLDTTFLSDFFTLNRNTFAHYLPVIHLTNAGEFGLQHLSSLPLAQLTPPDQIPKSLLTD
LTIRKIIRAVIAVAIAYGLMAVIQKVTNWISERVPRRFRLLVKQSLPFCKALILLFTISY
LLNLFFNLSEGNLLALTGTIAVALGFAFKDYISSIIAGVVALFEAPYRVGDRIQIGDHYG
EVTGYGLRGICLQTPDDNNVTIPHNKTWTEPISNANGGNLEAQVATSFYFDHSVDVEQVI
RILYQAAYSSRYTQLSIPIVVVMKEHIWGTEFKLRSYPMDARDEFAYQTDLIRRAKRAFG
QQGLPYPRLKLGRDESDT
Download sequence
Identical sequences Q55882
gi|383492642|ref|YP_005410319.1| 1148.slr0109 gi|383326758|ref|YP_005387612.1| gi|16331846|ref|NP_442574.1| gi|16331846|ref|NP_442574.1| gi|383323589|ref|YP_005384443.1| WP_010873872.1.11876 WP_010873872.1.1889 WP_010873872.1.18904 WP_010873872.1.33690 WP_010873872.1.35395 WP_010873872.1.47586 WP_010873872.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]