SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331853|ref|NP_442581.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331853|ref|NP_442581.1|
Domain Number 1 Region: 302-506
Classification Level Classification E-value
Superfamily PP2C-like 0.0000418
Family PP2C-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16331853|ref|NP_442581.1|
Sequence length 510
Comment hypothetical protein slr0114 [Synechocystis sp. PCC 6803]
Sequence
MMFRPLSRAIQVAMYYPIRIVAAAIILTALLFIPLGWSSWQTYLIFQNTVAVDFQLQAQA
GKIVHLDEVLTMSSQMAAATGDSEWEARYLKFEPELGAAIKQAIAIAPEAYEGEGAQETE
IANNRLVVMETKAFELVRQGNLSQAQAMLNSREYLGNKRIYIDGIARSELAIANRIQANL
ANFRQTLFFASTLAVVSLITLIPLWAVVLKVLQMYIKDREIARQEVLKANSQLEIKVAER
TADLAKANEAITGLNAQLKQENMRLGTELDVARKLQMMVLPKHEELSEITDLDIACYMAS
ATEVGGDYYDVVKIGNRIFISIGDVTGHGLESGVMAIMAQTAIQTLLTAEITEAVQFHNL
LNQVLYKNTQRMELSKNMTLVMLDYQSGELILSGQHESIFVVRADGAIEEIDTIDLGFPL
ALEKDITTFIARTQINLHSGDVVVLYTDGIPEAENGEKQFYGLARFQEVLIANHQSTALE
ISQAVVEDLMAYIGDSRVFDDITLVIFKKI
Download sequence
Identical sequences Q55889
1148.slr0114 gi|383323596|ref|YP_005384450.1| gi|16331853|ref|NP_442581.1| WP_010873879.1.11876 WP_010873879.1.1889 WP_010873879.1.18904 WP_010873879.1.33690 WP_010873879.1.35395 WP_010873879.1.47586 WP_010873879.1.99424 gi|16331853|ref|NP_442581.1| gi|383326765|ref|YP_005387619.1| gi|383492649|ref|YP_005410326.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]