SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331865|ref|NP_442593.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331865|ref|NP_442593.1|
Domain Number 1 Region: 135-239
Classification Level Classification E-value
Superfamily Cell-division inhibitor MinC, C-terminal domain 3.66e-29
Family Cell-division inhibitor MinC, C-terminal domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16331865|ref|NP_442593.1|
Sequence length 247
Comment septum formation inhibitor [Synechocystis sp. PCC 6803]
Sequence
MSDDTPHPEWQLVPQGNFVRLSLTLPTVTTAPDSPSLVFSHQQLEQSLGNYLRIMAGRWQ
DQTLVRLAVNNQLLDARQLQAIAAGLKEQNLTLQWVETNRRQTAVAAASAGLSVDQTMAD
KPLVDPSETPSLPKPLVVRHTLRSGGEIRHGGDVVIIGDVNPGSSIVADGDILIWGCLRG
MAHAGAKGNDQAVIMILRLAACQIRIGDRLARVGADAVDRREPEIAYITSEGIRLTPVRQ
FQRSALL
Download sequence
Identical sequences L8AP16 Q55901
gi|383326777|ref|YP_005387631.1| gi|16331865|ref|NP_442593.1| WP_010873891.1.11876 WP_010873891.1.1889 WP_010873891.1.18904 WP_010873891.1.33690 WP_010873891.1.35395 WP_010873891.1.47586 WP_010873891.1.99424 gi|383492661|ref|YP_005410338.1| gi|383323608|ref|YP_005384462.1| gi|16331865|ref|NP_442593.1| 1148.sll0288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]