SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331880|ref|NP_442608.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|16331880|ref|NP_442608.1|
Domain Number - Region: 205-282
Classification Level Classification E-value
Superfamily ARM repeat 0.000162
Family Armadillo repeat 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16331880|ref|NP_442608.1|
Sequence length 390
Comment hypothetical protein sll0281 [Synechocystis sp. PCC 6803]
Sequence
MVAIDNNLKIPLTSADHQWVKTIALQSGCQGEKLQRLIKNLLAVRAIAHWLEIYGIDYDE
GESYSRQPPIHLGETVADLYLPNLGRLECRGIGHQEEEIYFGAESWQDRLGYAVVEISED
LRQGEIFGFLESFTAEIVPKQQLQPIEGLFRVIATAEQASMVLAPVEVVQNAVNRVTDVI
QTWVERVTTTTWQLGTEQWVPQLIPVRSLGTVERIIDKFQGAKDEATKQRLIITLGELAT
ENDQPQAIAKLVEIIDGTNNEDTRWLAAGTLARIDAKHPQAVHSVTKTIAHDLALGQIPL
TLTVSLMPRGDHTIAGLITLQPLQSTQTLPAGLALALLTTDDQLIDSIGVGEEEQGGKNL
LKMSLEIDPGSDFRIRVSLGELAVTEDIHL
Download sequence
Identical sequences L8AP05 Q55916
gi|383323623|ref|YP_005384477.1| 1148.sll0281 gi|383492676|ref|YP_005410353.1| WP_010873906.1.11876 WP_010873906.1.1889 WP_010873906.1.18904 WP_010873906.1.33690 WP_010873906.1.35395 WP_010873906.1.47586 WP_010873906.1.99424 gi|383326792|ref|YP_005387646.1| gi|16331880|ref|NP_442608.1| gi|16331880|ref|NP_442608.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]