SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331949|ref|NP_442677.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331949|ref|NP_442677.1|
Domain Number 1 Region: 568-985
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.56e-138
Family DNA polymerase I 0.00000000967
Further Details:      
 
Domain Number 2 Region: 8-185
Classification Level Classification E-value
Superfamily PIN domain-like 7.36e-45
Family 5' to 3' exonuclease catalytic domain 0.0000351
Further Details:      
 
Domain Number 3 Region: 375-561
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.12e-38
Family DnaQ-like 3'-5' exonuclease 0.0000791
Further Details:      
 
Domain Number 4 Region: 187-301
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 4.34e-31
Family 5' to 3' exonuclease, C-terminal subdomain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16331949|ref|NP_442677.1|
Sequence length 986
Comment DNA polymerase I [Synechocystis sp. PCC 6803]
Sequence
MFMSAKSPLLLLVDGHSLAFRAYYAFGLSKKGPLRTTAGIPTSVCFGFLNSLMQVMESQK
PAAIAIAFDRREPTFRHEADGAYKSNRQETPEDFAEDLSYLQQLLEALNLQTITYAGYEA
DDILGTLACQGSDAGYQVKILSGDRDLFQLVSPEKNISVLYLTRNPFSSNTGYDELDWQG
VVDKMGVTPAQIVDFKALCGDKSDCIPGINGIGEKTAIKLLAEYETLEKVYENLAQIKGA
LKTRLDNGKDDAMHSQMLARIVVDVPLPVTWEDLQLTGFSTDRLVPLLEKLELRTFIDKI
QAFHRNFSDNQSPVPMGNEADNGEPKKTVKAKKSKEKVNPDDSQQLSLFDGVPVVNQEDG
LITIQLPKQIQPQIITTIAQLEALVEELKKHTDADFPVAWDTETDSLDPLVANLVGIGCA
WGQEPNQVAYIPLKHHQGEQLSLGIIKDLLGEILGNAIYPKVLQNAKFDRRVLAHHGIEL
GGVVLDTMLASYVLQPEETHNLTDLCRRYNLGLVALSYKDLGLKKDQTIADLPLETAGQY
CGLDCYATYLLASKLQKELDQYPELKEILKEIEQPLEKILAAMEDRGIRIDCDYLQTLSQ
QLAENLLTIETAAYEAAGESFNLSSPKQLGTILFDKLGLDRKKSRKTKTGYSTDHATLEK
LQGDHPIIDAILEHRTLAKLKSTYVDALPELVNGQTQRIHTDFNQAVTSTGRLSSSNPNL
QNIPIRSDFSRQIRRAFLPQKDWLLVSADYSQIELRILAHLSQEPVLLQAYGDRQDVHGV
TAKLLFGKEDITPAERNLGKTINFGVIYGMGAQRFARETGISAVEGREFIDRYHRTYAQV
FDYLETMKLEAIAKGYVTTIVGRRRYFNFVTEALRQLRGKTVTELDLVDVKMNYNDAQLL
RSAANAPIQGSSADIIKIAMVKLAKLLESYQTRMLLQVHDELIFEMPPEEWEELAPLIQN
TMEQALTLSVPLVVEMHRGSNWMEAK
Download sequence
Identical sequences L8ANU8 Q55971
gi|383326861|ref|YP_005387715.1| gi|16331949|ref|NP_442677.1| 1148.slr0707 gi|383492745|ref|YP_005410422.1| gi|16331949|ref|NP_442677.1| WP_010873972.1.11876 WP_010873972.1.1889 WP_010873972.1.18904 WP_010873972.1.33690 WP_010873972.1.35395 WP_010873972.1.47586 WP_010873972.1.99424 gi|383323692|ref|YP_005384546.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]