SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16331992|ref|NP_442720.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331992|ref|NP_442720.1|
Domain Number 1 Region: 190-450
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.22e-25
Family Leukotriene A4 hydrolase catalytic domain 0.031
Further Details:      
 
Domain Number 2 Region: 459-556
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000394
Family PDZ domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16331992|ref|NP_442720.1|
Sequence length 584
Comment hypothetical protein slr0031 [Synechocystis sp. PCC 6803]
Sequence
MLPTLPHLHYQVAMPTPQTHYFTVDLHIQGFTASVLELKFPVWTPGSYLVREYERHLQDF
QAQGLSNGEYLEHQKLGKAHWAIACGEEENIAISYRIYADELTVRTNHLDYSHGFFTGAA
LFFYLPGHTHRPLALTVVPPEPAWAIATALPCKATDSTTGAKTFYAQDFDTLVDSPVEVG
IHRDYAFETQGKEHHFVVWGESNLNGEQLVRDTEKIIAVEAGLFGNLPYDHYWFILHTSN
QGYGGLEHKDSCVLNYDRFGFRDPEKYQRFLQLVAHEFFHLWNIKRIRPIALEKFDYDQE
NYTPSLWFSEGTTSYYDLLIPLRAEIYDRQTYLKNLGKEITRYLKTLGRLVQPLAESSFD
AWIKLYRRDANSDNSQMSYYLKGELVTLMLDLLIRERHQNQRSFDDVLRAMWQEFGREEI
GFTPEQLQAVISRVADTDLTEFFHTYLHTTAELPLNDYLQPFGLVIKPMQEDLTPYLGIK
VKSEAGQEKITFVAAHSPAAMAGISPQDLLLAINGVRVGAEQLSLRLKDYQANDMIQLTV
FHQDLLRTVDVVLASPQANRYEVVPIADPSDSQLQNLAGWLGES
Download sequence
Identical sequences L8ALR6 Q55449
gi|16331992|ref|NP_442720.1| gi|383492788|ref|YP_005410465.1| gi|383326904|ref|YP_005387758.1| gi|383323735|ref|YP_005384589.1| WP_010874015.1.11876 WP_010874015.1.1889 WP_010874015.1.18904 WP_010874015.1.33690 WP_010874015.1.35395 WP_010874015.1.47586 WP_010874015.1.99424 1148.slr0031 SgR155 gi|16331992|ref|NP_442720.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]