SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16332019|ref|NP_442747.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16332019|ref|NP_442747.1|
Domain Number 1 Region: 37-264
Classification Level Classification E-value
Superfamily MetI-like 1.57e-51
Family MetI-like 0.00017
Further Details:      
 
Weak hits

Sequence:  gi|16332019|ref|NP_442747.1|
Domain Number - Region: 2-35
Classification Level Classification E-value
Superfamily MalF N-terminal region-like 0.00379
Family MalF N-terminal region-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16332019|ref|NP_442747.1|
Sequence length 279
Comment sugar ABC transporter membrane protein [Synechocystis sp. PCC 6803]
Sequence
MYVTPALLFLSAYLILPTLETVYLSFFDGRSRNFVGLKNYVFAFTDHTMLVAFRNNLLWL
VLVTGISVSLGLIIAVLVDKVRYEAIAKSIIFLPMAISFVGASVIWKFVYAYRPAGAEQI
GLLNAIVTSLGFAPVGWLVERSVNNFALIAIMIWLYTGFCMVILSAAVKGIPADVIEAAR
IDGANSWQIFWRITIPMIRSTLLVVSTTMVILVLKVFDIVFVMTGGNQGTEVIASLMIKE
MFNYRNFGRGSTIAVILLLLIVPVMITNIRRFKAQEKLR
Download sequence
Identical sequences Q55472
gi|383326931|ref|YP_005387785.1| gi|383492815|ref|YP_005410492.1| gi|16332019|ref|NP_442747.1| WP_010874042.1.11876 WP_010874042.1.1889 WP_010874042.1.18904 WP_010874042.1.33690 WP_010874042.1.35395 WP_010874042.1.47586 WP_010874042.1.99424 gi|383323762|ref|YP_005384616.1| 1148.slr0530 gi|16332019|ref|NP_442747.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]