SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16332034|ref|NP_442762.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16332034|ref|NP_442762.1|
Domain Number 1 Region: 112-462
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 4.79e-98
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000049
Further Details:      
 
Domain Number 2 Region: 463-584
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 2.81e-34
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00061
Further Details:      
 
Domain Number 3 Region: 2-103
Classification Level Classification E-value
Superfamily Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 6.15e-23
Family Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16332034|ref|NP_442762.1|
Sequence length 584
Comment arginyl-tRNA synthetase [Synechocystis sp. PCC 6803]
Sequence
MVSILTQLNDHFAQALEGQFPSDVTLPTPLVVPASNPKFGDFQCNIALPLAKQLGQPPRA
IAMEIVDKVNLSEICEPLTIAGPGFINIKLLPDYLGEQLIKLQQNQQLGVSLVKGEERIV
VDFSSPNIAKEMHVGHLRSTIIGDCLARVLEFRGYDVLRLNHVGDWGTQFGMLITYLKEV
YPEALVTADALDIGDLVTFYKQAKQRFDQDEQFRETSRQAVVALQAGDAKSIKAWQLLCE
QSRREFQLIYDCLDITIEERGESFYNPFLPGVVELLQEKDLLVEDNGAQCVFLDGFTNKD
GDRLPLIVQKSDGGYNYATTDLAALNYRLNTDGAEKIIYVTDAGQANHFAQFFQVAEKAG
ILTDPTQVVHVPFGLVKGEDGKKLKTRAGDTIRLKDLLTEAVTRARQDLETRLTAEERSE
TEEFKTEVAQRVGIGAVKYADLSQNRTSDYVFSFDKMLALQGNTAPYMLYAYARIQSISR
EGGIDFAQMDSGEIVLTEPTELVLAKNLLQFADVIETVEISLLPNRLCDYLYELSKVFNR
FYENCPVLKASDPQRGSRLLLCDLTARTLKLGLSLLGIPVLDRM
Download sequence
Identical sequences L8ANL5 Q55486
gi|383323777|ref|YP_005384631.1| 1148.sll0502 gi|383326946|ref|YP_005387800.1| gi|16332034|ref|NP_442762.1| WP_010874057.1.11876 WP_010874057.1.1889 WP_010874057.1.18904 WP_010874057.1.33690 WP_010874057.1.35395 WP_010874057.1.47586 WP_010874057.1.99424 gi|16332034|ref|NP_442762.1| gi|383492830|ref|YP_005410507.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]