SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16332078|ref|NP_442806.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16332078|ref|NP_442806.1|
Domain Number 1 Region: 13-215
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.5e-64
Family "Hypothetical" protein ybl036c 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16332078|ref|NP_442806.1|
Sequence length 218
Comment hypothetical protein slr0556 [Synechocystis sp. PCC 6803]
Sequence
MFSPSVYSEIIATLPPSVRLVAVTKTKAIADIEAAYGAGIRDFAESRIQEALPKIEALAN
YQDINWHFIGRLQSNKARKVVENFTYIHSVDNLAIAVKLDRIAEELNKFPQGLLQIKLLP
DENKSGWTREELKLDLPQLELLKNLKICGLMTILPLGLSPGDRQLTFGELKNLATAINQQ
SSLSLTELSMGMSGDYPEAIAAGATMIRLGTILFGDRL
Download sequence
Identical sequences L8APN4 P52056
1148.slr0556 NYSGRC-FDAO-BAA10877 gi|383326990|ref|YP_005387844.1| gi|383492874|ref|YP_005410551.1| gi|16332078|ref|NP_442806.1| gi|16332078|ref|NP_442806.1| gi|383323821|ref|YP_005384675.1| WP_010874100.1.11876 WP_010874100.1.1889 WP_010874100.1.18904 WP_010874100.1.33690 WP_010874100.1.35395 WP_010874100.1.47586 WP_010874100.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]