SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16332085|ref|NP_442813.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16332085|ref|NP_442813.1|
Domain Number 1 Region: 43-163
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 7.25e-27
Family Ferredoxin domains from multidomain proteins 0.011
Further Details:      
 
Weak hits

Sequence:  gi|16332085|ref|NP_442813.1|
Domain Number - Region: 3-61
Classification Level Classification E-value
Superfamily ARM repeat 0.0863
Family BC3264-like 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16332085|ref|NP_442813.1|
Sequence length 193
Comment NADH dehydrogenase subunit I [Synechocystis sp. PCC 6803]
Sequence
MFNNILKQVGDYAKESLQAAKYIGQGLAVTFDHMSRRPITVQYPYEKLIPSERFRGRIHF
EFDKCIACEVCVRVCPINLPVVDWEFNKAVKKKELKHYSIDFGVCIFCGNCVEYCPTNCL
SMTEEYELAAYDRHDLNYDNVALGRLPYKVTEDPMVTPLRELGYLPKGVIEPHNLPKGSQ
RAGQHPEDLVKAE
Download sequence
Identical sequences L8APQ5 P26525
WP_010874107.1.11876 WP_010874107.1.1889 WP_010874107.1.18904 WP_010874107.1.33690 WP_010874107.1.35395 WP_010874107.1.47586 WP_010874107.1.99424 gi|383326997|ref|YP_005387851.1| gi|383323828|ref|YP_005384682.1| gi|16332085|ref|NP_442813.1| gi|383492881|ref|YP_005410558.1| 1148.sll0520 gi|16332085|ref|NP_442813.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]