SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16332092|ref|NP_442820.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16332092|ref|NP_442820.1|
Domain Number 1 Region: 222-462
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.12e-71
Family Leukotriene A4 hydrolase catalytic domain 0.001
Further Details:      
 
Domain Number 2 Region: 21-213
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 4.84e-45
Family Leukotriene A4 hydrolase N-terminal domain 0.0014
Further Details:      
 
Domain Number 3 Region: 559-851
Classification Level Classification E-value
Superfamily ARM repeat 1.5e-19
Family PBS lyase HEAT-like repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16332092|ref|NP_442820.1|
Sequence length 869
Comment aminopeptidase [Synechocystis sp. PCC 6803]
Sequence
MSFLTFDTESNQRKSFELPGAKPHYNPDRPGQVNHIFLDLKINLEERHLQGVCRIALTPV
RAGIEQLTLDAVDLKIAWVLIKGVSQSFDYDGEKLTINPLQPLGTEPVTLEIQYELKNPR
RGIYFIQPDRHYPDKPVQVWTQGEDEDSRYWFPCFDYPGQLATSEIRVQVAKPHRVISNG
SLIEQKDLGNEQIFHWSQSQIHPTYLMTLAIGDFAEIVDHYGDLPVRYYVEKGREADGQR
SMGKTPRMIEFFNQTFGYPYAYPNYDQVCVADFIFGGMENTSTTLLMDRCLLDERAALDN
RNTESLVAHELAHQWFGDLVVVKHWSHAWLKEGMASYAEVLWTDHEYGQDEAAYYLLGEA
RNYLAEDSSRYRRPIVTHVYREAIELYDRHLYEKGACVYHMIRAVLGDELFFRAVHTFVN
DHAHGTVETVDLLRAIEKATGFNLLWLFDQYVFRGGHPEFKVSYSWDNDNKLAKLTVTQT
QAKANSDHKDLFNLKIPVAFNFLDGEKVTSQVIPLQLKEREQVFYFPLTRKPDFISFDQG
NNFLKTVELAYPLTELKAQCTHDPDPIARIQAAIAIGKQGGLEAVEFLGERLQKEAFWGV
RVEIAEQLAGINLEQAGTALINGLDKNDHPKVRRAIISALAKVKTEASYEALKKCLTQGE
TSYYAEAAAATALGALGTGLLKNNEGEIIQQLTEVLKNRSGWNEVVRCGAIAGLSQLTTS
AQAVDAILAYTANGTPQPLRLAAIRALGAVSIGQSPEKLTEILERLTAIAQEEFFLTQVS
VTSALGQMETPKAIDISQNLANQTPDGRVRRMAEEAVKKVQAKIGSDEKIKNLQTNLEKL
QQENQDLQSRLAKLETVIKASTDTSVTNL
Download sequence
Identical sequences L8APM1 P74527
gi|383492888|ref|YP_005410565.1| 1148.sll1343 gi|383327004|ref|YP_005387858.1| gi|383323835|ref|YP_005384689.1| WP_010874114.1.11876 WP_010874114.1.1889 WP_010874114.1.18904 WP_010874114.1.33690 WP_010874114.1.35395 WP_010874114.1.47586 WP_010874114.1.99424 gi|16332092|ref|NP_442820.1| gi|16332092|ref|NP_442820.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]