SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16332101|ref|NP_442829.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16332101|ref|NP_442829.1|
Domain Number 1 Region: 6-269
Classification Level Classification E-value
Superfamily Pentein 8.83e-57
Family Dimethylarginine dimethylaminohydrolase DDAH 0.019
Further Details:      
 
Domain Number 2 Region: 618-699
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.0000425
Family Pyruvate oxidase and decarboxylase, middle domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16332101|ref|NP_442829.1|
Sequence length 705
Comment hypothetical protein sll1336 [Synechocystis sp. PCC 6803]
Sequence
MADDIRILMCPPDHYDVDYVINPWMEGNIHKSSQERAVEQWKKLHQTIKECAIVDLVKPA
KGWPDMVFTANAGLVLGENVVLSRFYHKERQGEEPYFKAWFEENGFTVYELPQDLPFEGA
GDALFDREGRWLWAGYGFRSELDSHPYIAKWLDTEVVSLRLIDERFYHLDTCFCPLSGGY
LLYYPPAFDAYSNRVIEMRIPPEKRIIVEELDAVNFACNAVNVNDIIIMNLVSRTLKEKL
AEAGFKVRETPLTEFLKAGGAAKCLTLRVTEPILPDVHATVSIESRVIRMEGHLLDAGIL
NQALDLVVENSGSFRVLNFNLGVERNSTSSAEVRVSAPSHQIMEEIMTELIDLGAVPPPQ
ELCDINTETVTQGGVAPDDFYVSTIYPTEVRVNCEWVQVTGQRMDAAIVVTSNPPSARCV
LLRDLQVGDRVMVGVEGIRTIKKVESHEGGTRKENKEFAFMAAGVSSERRVELLVEQIAW
EMRQIRDQGGKIVVTAGPVVIHTGGAQHLSHLVREGYVHALLGGNAIAVHDIEQATMGTS
LGVDMQRGIPVRGGHRHHLKIINSVRRYGGIRQAVEAGFISKGVMYECVKNNIPYCLAGS
IRDDGPLPDTEMNLVRAQSRYSELIQGADMILMLSSMLHSIGVGNMTPSGVKMVCVDINP
AVVTKLSDRGSVESVGVVTDVGLFLSLLVRQLQQLTRPYSLAETL
Download sequence
Identical sequences L8ALI9 P74535
gi|383327013|ref|YP_005387867.1| SgR221 gi|383323844|ref|YP_005384698.1| gi|383492897|ref|YP_005410574.1| 1148.sll1336 gi|16332101|ref|NP_442829.1| WP_010874123.1.11876 WP_010874123.1.1889 WP_010874123.1.18904 WP_010874123.1.33690 WP_010874123.1.35395 WP_010874123.1.47586 WP_010874123.1.99424 gi|16332101|ref|NP_442829.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]