SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16332120|ref|NP_442848.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16332120|ref|NP_442848.1|
Domain Number 1 Region: 16-190
Classification Level Classification E-value
Superfamily Rhomboid-like 1.7e-28
Family Rhomboid-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16332120|ref|NP_442848.1|
Sequence length 198
Comment hypothetical protein slr1461 [Synechocystis sp. PCC 6803]
Sequence
MSQNSKTALRATLQSQFSIIVSFLAIFWLLEILDAFVFRGSLDQFGIYPRSLEGLRGIVF
APFLHADFGHLIANSVPFVVLAWLVMLQEVSDFWIVTIITMVVGGLGVWLIAPPNTVTVG
ASILIFGYLGFLLFRGWFQKNLASIVLSIVVLVLYGSALWGLLPGRAGVSWQGHLFGFIG
GAIAAWLIAREKHYYSKN
Download sequence
Identical sequences L8ALH7 P74553
gi|383327032|ref|YP_005387886.1| gi|16332120|ref|NP_442848.1| gi|383323863|ref|YP_005384717.1| WP_010874142.1.11876 WP_010874142.1.1889 WP_010874142.1.18904 WP_010874142.1.33690 WP_010874142.1.35395 WP_010874142.1.47586 WP_010874142.1.99424 gi|16332120|ref|NP_442848.1| 1148.slr1461 gi|383492916|ref|YP_005410593.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]