SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16332138|ref|NP_442866.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16332138|ref|NP_442866.1|
Domain Number 1 Region: 27-707
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.18e-180
Family Neurolysin-like 0.00000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16332138|ref|NP_442866.1|
Sequence length 713
Comment oligopeptidase A [Synechocystis sp. PCC 6803]
Sequence
MVYPQTFFLRLKPFRFSITMTHTAVANPLLQGRDLPAFDKIQPTDVEPAVTTLVQELEAQ
LTELEKSVQPTWEGLVEPLTALEEKLSWTWGTVSHLMGVKNSPELRHGFEQVQPLVVGFI
SRLGQSRPLYEAFVALRDSAEWGNLEPAQQRIVESNIREAELGGVGLTGEKRDRFNAIQL
ELAELATKFSNNVLDASQAFELKLTTKEEIAGLPPSLLALAAQTAQQKGEDNATPEEGPW
LITLDYPSYLPFMKYSQREDLREKVYRAFIRRAADGQWDNHPLIERILALRLEKAQLLGF
ETYAELSLSRKMAPNVAAVEKLLEELRVPSYKAAEQEFADLQKFAGVEELHHWDTAYWSE
RQREQEFDFDAEALRPYFPLPQVLEGLFALAKRLFGVTIQASEEEVPVWHPDVQFFRVLD
ESGTAIASFYLDAYSRPAEKRGGAWMADCLNRGQELINGQKSLRLPVAYLICNQTPPVGD
QPSLMTFYEVTTLFHEFGHGLQHLLTTVNYSGAAGINNVEWDAVELPSQFMENWCYDPTT
LFSLAKHYQTGETLPQAEYEKILATRNFMTGSAMLRQINFSLLDLELHHRYRPDGPETIE
QIGDRLAKITTILPPLPENAFLCSFGHIFAGGYAAGYYSYKWAEVLSADAFAAFEEVGLD
NEAAVQTTGKRFRETVLALGGSLAPAVVFEKFRGRQPQTAPLLRHNGLLPSAT
Download sequence
Identical sequences P74571
1148.slr0659 gi|16332138|ref|NP_442866.1| gi|16332138|ref|NP_442866.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]