SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16332143|ref|NP_442871.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16332143|ref|NP_442871.1|
Domain Number 1 Region: 107-394
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.08e-63
Family Alanine racemase-like, N-terminal domain 0.0022
Further Details:      
 
Domain Number 2 Region: 488-619
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.0000453
Family Eukaryotic ODC-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16332143|ref|NP_442871.1|
Sequence length 695
Comment arginine decarboxylase [Synechocystis sp. PCC 6803]
Sequence
MEGQSIELELSVMAMPELIDSTEAGHTAGVKTDSNPQAIAQDRRWTIDDSENLYRITGWG
EPYFSINAAGHVTVSPQADHGGALDLYELVKGLRQRNIGLPLLLRFSDILADRINRLNAA
FARGIARYRYPNTYRGVYPIKCNQHRHIVESLVRYGTPYNFGLEAGSKPELMIALAMLQP
QENPEPDQQNQPLLICNGYKDREYIETALLARRLGHRPIIVVEQVAEVALAIEISSNLGI
KPILGVRAKLSTQGMGRWGISTGDRAKFGLTIPEMLTAIEQLRRADMLDSLQLLHFHIGS
QISSISVIKEAMTEASQIFVQLAKLGANMRYLDVGGGLGVDYDGSKTNFYASKNYNIQNY
VNDVISAVQDACVAAEVPCPVLISESGRAIASHQSVLIFDVVATNDINPPLPKVKGKDHA
ILRNLMETWETITVDNYQEAYHDVEQFKTEAISLFNFGYLGLKERAKAEELYWACCRKIL
QICRQQEYVPDDLENLEVNLASIYYANMSVFQSAPDSWAIDQLFPIMPIHRLDEEPTQRG
ILADITCDSDGKIDQFIDLRDVKSVLELHPLIEVHQPGTPPRVEPYYLGMFLVGAYQEIM
GNLHNLFGDINVVHIQMNPKGYQIEHLVRGDTIAEVLGYVQYDPEDLLENMRRYCEQAME
DKRMSLEEAQLLLENYERSLLQYTYLKPTSGIHTS
Download sequence
Identical sequences L8ALG0 P74576
NYSGRC-FDAO-BAA18683 SgR25 gi|383327055|ref|YP_005387909.1| gi|16332143|ref|NP_442871.1| gi|16332143|ref|NP_442871.1| gi|383323886|ref|YP_005384740.1| 1148.slr0662 WP_010874165.1.11876 WP_010874165.1.1889 WP_010874165.1.18904 WP_010874165.1.33690 WP_010874165.1.35395 WP_010874165.1.47586 WP_010874165.1.99424 gi|383492939|ref|YP_005410616.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]