SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16332152|ref|NP_442880.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|16332152|ref|NP_442880.1|
Domain Number - Region: 69-174
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0471
Family DNA repair protein MutS, domain III 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16332152|ref|NP_442880.1|
Sequence length 178
Comment hypothetical protein slr0668 [Synechocystis sp. PCC 6803]
Sequence
MLKKVSFSSENLSLLNIADYYGDSEKALRLFFSPKNPAYTLRFNGYTRNEVEGELKLRLQ
ELDKAVSLSILSALEALLRVDYLTRCYKKKKDPLSRKMRNIYKSKGVRASLERDILRLWK
EICPEYKSFISEVITAFDYRNWLAHGRYWEPKLGRNFDYSSLYDLAESIEQLLISSRT
Download sequence
Identical sequences L8APK6 P74585
gi|16332152|ref|NP_442880.1| gi|383492948|ref|YP_005410625.1| WP_010874174.1.11876 WP_010874174.1.1889 WP_010874174.1.18904 WP_010874174.1.33690 WP_010874174.1.35395 WP_010874174.1.47586 WP_010874174.1.99424 gi|383323895|ref|YP_005384749.1| gi|383327064|ref|YP_005387918.1| 1148.slr0668 gi|16332152|ref|NP_442880.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]