SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16332157|ref|NP_442885.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16332157|ref|NP_442885.1|
Domain Number 1 Region: 1-308
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.23e-73
Family Cytidylytransferase 0.019
Further Details:      
 
Domain Number 2 Region: 246-430
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 1.12e-29
Family gamma-carbonic anhydrase-like 0.053
Further Details:      
 
Domain Number 3 Region: 636-743
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 3.92e-19
Family Phosphoglucomutase, first 3 domains 0.0082
Further Details:      
 
Domain Number 4 Region: 744-833
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.00000000000204
Family Phosphoglucomutase, C-terminal domain 0.009
Further Details:      
 
Domain Number 5 Region: 374-557
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.00000000000447
Family Phosphoglucomutase, first 3 domains 0.0042
Further Details:      
 
Domain Number 6 Region: 531-631
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.0000000000706
Family Phosphoglucomutase, first 3 domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16332157|ref|NP_442885.1|
Sequence length 843
Comment mannose-1-phosphate guanylyltransferase [Synechocystis sp. PCC 6803]
Sequence
MRAVLMAGGAGTRLRPLTCDLPKPMVPIVNQPIAAHIIHLLRRHNITEVVATLHYLPDAM
RDYFLDGSEFGVQMTYAVEDEHPLGTAGCVKNIEELLDDTFLVISGDSITDFNLTQAIAF
HKQKQAKATLILTKVPNPLEFGVVITDENQRVQRFLEKPSTSEVFSDTVNTGTYILEPEV
LAYLPPKEEMDFSKDLFPLLLENDEPMYGFVADGYWCDVGNLDAYREAQYDALEKKVTLE
LGNLPRHSDIWIGENTTIDPTAILTPPLAIGDNCNIGSGTKLEAGTIIGDNVTIGAGAEL
KRAIVWNGVLIGDEAYLAACVVGRGCRIERRVQVLEGAVIGPLSIIGEEAQINSNVKVWP
SKRVEPGAILNINLIWGSTGHRNLFGQRGVSGIVNIDMTPEFAVKLGAAYGSSLRPGAEI
VVSRDQRNVSRMVTRSLIAGLMSVGVNIQNLEATAIPIARTMTPKLKVAGGIHVRIHPDR
PDYLLIEFLDSQGINISKKTEKKIEGAYFKEDLRRVSIPQIGDMSYPAQVLETYCHTFEK
LLDMDIINNDGAKIVIDYAYGVSGAILPLLLTKFGCDAVVLNASLRQTAVSNEEKEVLLS
QLGQVVSALQANLGVQVSANGEQLTLVDEGGLPIRGELLTALMVHMVLTASPRGTIVVPV
QASSAVEHLARRHGGKVLRTKANPTALMAAAQSSHNVVLGGSGETGFIFPRLHPGFDAMF
CIAKVMEMLTVQKRTLGEIRSELPTVYHNSCSVRCSWKIKGALMRHLVEIHRDQHIELVD
GVKMTFPHGDNWVLILPDAGEPLVHIYANSEDRHWVDEKLRYYQAQVLNFISDAQEESYQ
HFS
Download sequence
Identical sequences L8ALE9 P74589
gi|383492953|ref|YP_005410630.1| WP_010874179.1.11876 WP_010874179.1.18904 WP_010874179.1.33690 WP_010874179.1.35395 WP_010874179.1.47586 WP_010874179.1.99424 gi|16332157|ref|NP_442885.1| SgR101 gi|16332157|ref|NP_442885.1| gi|383323900|ref|YP_005384754.1| 1148.sll1496 gi|383327069|ref|YP_005387923.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]