SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16332192|ref|NP_442920.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16332192|ref|NP_442920.1|
Domain Number 1 Region: 37-221
Classification Level Classification E-value
Superfamily GAF domain-like 3.27e-57
Family GAF domain 0.00016
Further Details:      
 
Domain Number 2 Region: 249-375
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.92e-21
Family Heme-binding PAS domain 0.017
Further Details:      
 
Domain Number 3 Region: 373-469
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000596
Family Flavin-binding PAS domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16332192|ref|NP_442920.1|
Sequence length 481
Comment chromatic adaptation sensor receptor protein [Synechocystis sp. PCC 6803]
Sequence
MGKFLIPIEFVFLAIAMTCYLWHRQNQERRRIEISIKQQTQRERFINQITQHIRQSLNLE
TVLNTTVAEVKTLLQVDRVLIYRIWQDGTGSAITESVNANYPSILGRTFSDEVFPVEYHQ
AYTKGKVRAINDIDQDDIEICLADFVKQFGVKSKLVVPILQHNRASSLDNESEFPYLWGL
LITHQCAFTRPWQPWEVELMKQLANQVAIAIQQSELYEQLQQLNKDLENRVEKRTQQLAA
TNQSLRMEISERQKTEAALRHTNHTLQSLIAASPRGIFTLNLADQIQIWNPTAERIFGWT
ETEIIAHPELLTSNILLEDYQQFKQKVLSGMVSPSLELKCQKKDGSWIEIVLSAAPLLDS
EENIAGLVAVVADITEQKRQAEQIRLLQSVVVNTNDAVVITEAEPIDDPGPRILYVNEAF
TKITGYTAEEMLGKTPRVLQGPKTSRTELDRVRQAISQWQSVTVEAEVLNDSYKEKKSPL
K
Download sequence
Identical sequences L8APC7 P74623
gi|16332192|ref|NP_442920.1| gi|16332192|ref|NP_442920.1| APC68189.0 1148.sll1473 WP_010874213.1.35395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]