SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16332228|ref|NP_442956.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16332228|ref|NP_442956.1|
Domain Number 1 Region: 494-720
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.31e-67
Family ABC transporter ATPase domain-like 0.000011
Further Details:      
 
Domain Number 2 Region: 170-486
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 4.45e-50
Family ABC transporter transmembrane region 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16332228|ref|NP_442956.1|
Sequence length 733
Comment hemolysin secretion ATP-binding protein [Synechocystis sp. PCC 6803]
Sequence
MVSLKQNLLGVKNRITCMAKYQWVQQQSGEDCAAASLAIIAKHHGRNIRINRIRALVGTR
QGGTTLLGLKYGAQELGFITSAIQAEPEILDELDEWALPAIIFWKGYHFVVLYGQEKDKY
VIADPAIGVRYLDRQEVIKGWQGGMMLLLEPDPKGFISQLDEDPVHPVDNLLKRLWEYRE
IFGKLFPLNLAVGIFSLSTPLLLKFLTDSVLTKSDTQKLTWVAIGVILITVVNAICSFLQ
SNLVASFAEELQKGLKLEFGLQILNLPITYHEARRSGTAIRRLSDIQRINLLVSQLVIDL
PIKTFIGLVALGFIVFYSWQLAAIVAAIGGIMTLSTIAFQPIVRQTTYRSITMAGENAGL
LAESFNGALATKTTAASPQLWLEIQHRLQREFKLNYRTAQIRIINNTFSQLMAGIGTVIM
LWYGSVLVFGNQLSIGQLIAIYGLQQSFLLLITTLVQFFTDFTQVKAITRLLAELFEYEP
ENQGDDLKDPIEISPQDDIDCQNISFYYPGRVKLIEDLSVTIPGGKVVGLIGKSGCGKST
LAKILTGLYSVQAGEINIGNHSLGDFSLICLRKQVVLVSQDAFFFHRSIIDNFRLSSPDI
TLEQVISACQIAQAHEFVSQFPEQYETILGAVAANISGGQKQRLAIARAIVNDPAVLILD
ESTANLDPVTEAEVLNSLLTKRQGKTTILISHRPKVINCADWIIFLESGKVKFSNTIKKF
RSEFGNASDFLSP
Download sequence
Identical sequences L8APP5 P74652
WP_010874249.1.11876 WP_010874249.1.1889 WP_010874249.1.18904 WP_010874249.1.33690 WP_010874249.1.35395 WP_010874249.1.47586 WP_010874249.1.99424 gi|16332228|ref|NP_442956.1| gi|383493022|ref|YP_005410699.1| gi|383323969|ref|YP_005384823.1| gi|383327138|ref|YP_005387992.1| 1148.slr1651 gi|16332228|ref|NP_442956.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]