SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16332301|ref|NP_443029.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16332301|ref|NP_443029.1|
Domain Number 1 Region: 174-398
Classification Level Classification E-value
Superfamily Argininosuccinate synthetase, C-terminal domain 1.14e-91
Family Argininosuccinate synthetase, C-terminal domain 0.00000133
Further Details:      
 
Domain Number 2 Region: 5-206
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 6.4e-44
Family N-type ATP pyrophosphatases 0.00000651
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16332301|ref|NP_443029.1|
Sequence length 400
Comment argininosuccinate synthase [Synechocystis sp. PCC 6803]
Sequence
MGRAKKVVLAYSGGVDTSVCIPYLMHEWGVEEVITLAADLGQGDELGPIQEKALRCGAVE
SLVIDGKEEFVKEYAFRSIQANALYENRYPLSTALARPLIAKMLVEAAEKYGADAVAHGC
TGKGNDQVRFDISIMALNPNLKVLAPAREWKMSREETIAYGERYGVESPVKKSSPYSIDR
NILGRSIEAGPLEDPMTEPTEEIYLMTKAIADTPDEPEYVDIGFEKGIPVSLNGVMLDPV
TLVERLNEIAGNHGVGRLDMVENRVVGIKSREIYEAPALLVLIDAHRDLESLTQTADVTH
YKNTVEEIYSQLIYRGLWYSPLKEALDAFIVKTQERVTGMVRVKFFKGNANVAGRKSDYS
IYDAELATYGMEDQFDHKAAEGFIYIWGLPTKVWAQKMRG
Download sequence
Identical sequences L8AKX2 P77973
WP_010874321.1.11876 WP_010874321.1.1889 WP_010874321.1.18904 WP_010874321.1.33690 WP_010874321.1.35395 WP_010874321.1.47586 WP_010874321.1.99424 gi|383327211|ref|YP_005388065.1| gi|383493095|ref|YP_005410772.1| 1148.slr0585 gi|383324042|ref|YP_005384896.1| gi|16332301|ref|NP_443029.1| gi|16332301|ref|NP_443029.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]