SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16332304|ref|NP_443032.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16332304|ref|NP_443032.1|
Domain Number 1 Region: 104-303
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 8.37e-51
Family BC ATP-binding domain-like 0.00032
Further Details:      
 
Domain Number 2 Region: 5-100
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.73e-23
Family BC N-terminal domain-like 0.0083
Further Details:      
 
Domain Number 3 Region: 310-367
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 0.00000000000000133
Family BC C-terminal domain-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16332304|ref|NP_443032.1|
Sequence length 388
Comment phosphoribosylaminoimidazole carboxylase ATPase subunit [Synechocystis sp. PCC 6803]
Sequence
METKLTTVGVIGGGQLAWMMAQEAPRLGLKLAVQTPGESDPAVALADKVVLTAIADGEGT
RELAEHCGVITFENEFVDLPSLEKLAQQGITFHPRLDALAPLLDKWEQRHFLQNLGLPVP
DFWALESLPAQLPDFPWVLKARRHGYDGQGTQIINSPADLPDLSKAPPGSWMVESFVPYE
RELAVIGVRNARGEMEIYPVVETKQIDQVCRWVVAPAPIDAAIAATAQDYCRRILNHLDY
VGILAIEFFLLPASTQTPTPEQRLLVNELAPRTHNSGHFSLDACHTSQFALQLQAVTGQT
LGSSALRCGQAVMVNLLGYEVSTGDYQQQLDKLAALPHSHVHWYGKGDCRPGRKLGHVTL
LNPDVESEPSTAWAEDLVKQVEAIWYPD
Download sequence
Identical sequences L8AP04 P74724
gi|16332304|ref|NP_443032.1| gi|383493098|ref|YP_005410775.1| 1148.sll0578 WP_010874324.1.11876 WP_010874324.1.1889 WP_010874324.1.18904 WP_010874324.1.33690 WP_010874324.1.35395 WP_010874324.1.47586 WP_010874324.1.99424 gi|383324045|ref|YP_005384899.1| gi|16332304|ref|NP_443032.1| gi|383327214|ref|YP_005388068.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]