SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16332305|ref|NP_443033.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16332305|ref|NP_443033.1|
Domain Number 1 Region: 39-140
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.83e-22
Family Pentapeptide repeats 0.0000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16332305|ref|NP_443033.1|
Sequence length 169
Comment hypothetical protein sll0577 [Synechocystis sp. PCC 6803]
Sequence
MLKVFRQSFLVVLTVACLIWSAPAIAASSSSVTGGASAFENMVLAETDFRDQDLLTAQFT
NVDLTSSIFEAMDLRGSVFNGANLTDANLKGVDLTNGLTYLTSFNGANLENAILAEAIML
RTSFKNAKIQGADFSLAVLDTEQIAALCKVADGVNPKTGISTRESLGCS
Download sequence
Identical sequences L8AMP3 P74725
gi|16332305|ref|NP_443033.1| gi|383327215|ref|YP_005388069.1| 1148.sll0577 WP_010874325.1.11876 WP_010874325.1.1889 WP_010874325.1.18904 WP_010874325.1.33690 WP_010874325.1.35395 WP_010874325.1.47586 WP_010874325.1.99424 gi|383493099|ref|YP_005410776.1| gi|383324046|ref|YP_005384900.1| gi|16332305|ref|NP_443033.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]