SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16332327|ref|NP_443055.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|16332327|ref|NP_443055.1|
Domain Number - Region: 26-92
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0785
Family ABC transporter transmembrane region 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16332327|ref|NP_443055.1|
Sequence length 128
Comment hypothetical protein slr0601 [Synechocystis sp. PCC 6803]
Sequence
MSTENPIETKSPENNQSLDCSSPDPSRKWYQARLFSFGITPTGYVAVGVAPMGVVAIGIV
PMGVISVGMVGMGAIAAGFVTMGMVAFGEVNMSYFGGHKGGKGHGAMPTQEMPMTDKPME
KPMEHSNH
Download sequence
Identical sequences L8AE47 P74747
WP_010874347.1.11876 WP_010874347.1.1889 WP_010874347.1.18904 WP_010874347.1.33690 WP_010874347.1.35395 WP_010874347.1.47586 WP_010874347.1.99424 gi|16332327|ref|NP_443055.1| gi|383324068|ref|YP_005384922.1| gi|383327237|ref|YP_005388091.1| gi|16332327|ref|NP_443055.1| gi|383493121|ref|YP_005410798.1| 1148.slr0601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]