SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|38505546|ref|NP_942167.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38505546|ref|NP_942167.1|
Domain Number 1 Region: 5-72
Classification Level Classification E-value
Superfamily YggU-like 3.53e-22
Family YggU-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|38505546|ref|NP_942167.1|
Sequence length 73
Comment hypothetical protein ssr5011 [Synechocystis sp. PCC 6803]
Sequence
MKKQVKVKPNAKQSKVVYGDDGSLIIHVKSPPVDGKANQELIKLLAKEFNVSQQSIKIKS
GAGSRQKIVEINE
Download sequence
Identical sequences Q6ZEW9
WP_011153548.1.1889 WP_011153548.1.35395 1148.ssr5011 gi|38505546|ref|NP_942167.1| gi|38505546|ref|NP_942167.1| gi|38505546|ref|NP_942167.1|NC_005229 gi|451816554|ref|YP_007459757.1|NC_020296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]