SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|38505546|ref|NP_942167.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38505546|ref|NP_942167.1|
Domain Number 1 Region: 5-72
Classification Level Classification E-value
Superfamily YggU-like 3.53e-22
Family YggU-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|38505546|ref|NP_942167.1|
Sequence length 73
Comment hypothetical protein ssr5011 [Synechocystis sp. PCC 6803]
Sequence
MKKQVKVKPNAKQSKVVYGDDGSLIIHVKSPPVDGKANQELIKLLAKEFNVSQQSIKIKS
GAGSRQKIVEINE
Download sequence
Identical sequences Q6ZEW9
gi|38505546|ref|NP_942167.1|NC_005229 gi|451816554|ref|YP_007459757.1|NC_020296 gi|38505546|ref|NP_942167.1| 1148.ssr5011 gi|38505546|ref|NP_942167.1| WP_011153548.1.1889 WP_011153548.1.35395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]