SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|38505549|ref|NP_942170.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38505549|ref|NP_942170.1|
Domain Number 1 Region: 126-315
Classification Level Classification E-value
Superfamily Homing endonucleases 9.35e-41
Family Group I mobile intron endonuclease 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|38505549|ref|NP_942170.1|
Sequence length 318
Comment hypothetical protein sll5014 [Synechocystis sp. PCC 6803]
Sequence
MSQIFQCPYCKALAIWKKGNYIHRRTCENSECRKKLNRDTAKKYDQLRQKKKIQELKFQG
FNIVTCQICNEEFEMIHHSHLKTHGLTVAEYRNRFPNALICNSRNHKKRSQAALERSKYK
SYSGKNIDNDFLEFLTGSLLGDGSLEKGKKKLNARYAEGGANKEYINWKFNFLKDYFYCT
FQECLSSPHVKSGKQYQGWWIRTGVHPILTDLHCIWYLEKKLLPRKFVEKYLTEFAFCIW
FYDDGCSSSGLSLYPMSFSEDDVNFLSLIILQKFNLKNSVLKTKQGHFFIRISQKAKSEL
KAILDKFSIPGMAYKRNL
Download sequence
Identical sequences Q6ZEW6
gi|38505549|ref|NP_942170.1| gi|38505549|ref|NP_942170.1| gi|38505549|ref|NP_942170.1|NC_005229 gi|451816557|ref|YP_007459760.1|NC_020296 WP_011153551.1.1889 WP_011153551.1.35395 1148.sll5014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]