SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|38505551|ref|NP_942172.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38505551|ref|NP_942172.1|
Domain Number 1 Region: 5-55
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000077
Family Phage repressors 0.042
Further Details:      
 
Weak hits

Sequence:  gi|38505551|ref|NP_942172.1|
Domain Number - Region: 331-376
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.00318
Family Endonuclease I 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|38505551|ref|NP_942172.1|
Sequence length 458
Comment hypothetical protein slr5016 [Synechocystis sp. PCC 6803]
Sequence
MGKAGQALKQTLDLHNISQSRLAIALGVDRPIVFRWFHEKTDPTGETIHQITTALQNLDP
DAASSFVNFYLGNFTQNGSSGISSQSLPESEQVNVSILAQLFNKTTNSYKYLFFLSLLDI
LKRRKFDVLPPISFAELVVEILANAWFPHTYFKLSFGTQDKITEKLDSLNLIISEPILKF
NDPDKQLLRKTIANQTYDDLITYLVKYVPFRLIRPFYSHETRGLKDVEVNQVILDLTNNN
HKSRNALYHFDADLVKDCQGIILSPDWVNYIEENFKIVKGWASWAWLEYMQSRNPTTPNI
VNKLFTPQQRGSLSSQTKFWKSALNYQLFNCIYSKQKLNSDYLSLDHYLPWSFVAHDQLW
NLVPVIPEVNSSKSNNLPADQYFYDFVNLHHLALVTNHKHLPRQSWNKVIDPYVADLNLS
ENDLLDLDRLLKAYESTVKPLITLAAKQGFSENWVYPK
Download sequence
Identical sequences Q6ZEW4
WP_011153553.1.1889 WP_011153553.1.35395 1148.slr5016 gi|38505551|ref|NP_942172.1| gi|38505551|ref|NP_942172.1|NC_005229 gi|451816559|ref|YP_007459762.1|NC_020296 gi|38505551|ref|NP_942172.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]