SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|38505556|ref|NP_942177.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38505556|ref|NP_942177.1|
Domain Number 1 Region: 10-94
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 7.6e-28
Family SinR domain-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|38505556|ref|NP_942177.1|
Sequence length 104
Comment hypothetical protein slr5021 [Synechocystis sp. PCC 6803]
Sequence
MNPDKLKPIHPGEVLLEEFLQPMNLSQNKLALAIRVPARRINEIVQGKRRITADTALRLA
LYFNMSPRFWLGLQMDYDLDLAEDEIGEKLQQEVTTFNLDNVAV
Download sequence
Identical sequences Q6ZEV9
gi|38505556|ref|NP_942177.1| 1148.slr5021 gi|38505556|ref|NP_942177.1|NC_005229 gi|451816564|ref|YP_007459767.1|NC_020296 gi|38505556|ref|NP_942177.1| WP_011153558.1.1889 WP_011153558.1.35395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]