SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|38505567|ref|NP_942188.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|38505567|ref|NP_942188.1|
Domain Number - Region: 11-83
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0667
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|38505567|ref|NP_942188.1|
Sequence length 116
Comment hypothetical protein sll5032 [Synechocystis sp. PCC 6803]
Sequence
MNSENLAALKPYLSFFHPITMWALLALAIYTLYLGIQVRRTRLAEGEPKKELIKGRFAIR
HHQIGSMFLALIVMGAIGGITVTYINSGKIFIGPHLFAGLGIVGLVSTSAALVPFM
Download sequence
Identical sequences Q6ZEU8
gi|38505567|ref|NP_942188.1| 1148.sll5032 gi|38505567|ref|NP_942188.1|NC_005229 gi|451816575|ref|YP_007459778.1|NC_020296 gi|38505567|ref|NP_942188.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]