SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|38505593|ref|NP_942214.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38505593|ref|NP_942214.1|
Domain Number 1 Region: 181-414
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000392
Family Extended AAA-ATPase domain 0.069
Further Details:      
 
Weak hits

Sequence:  gi|38505593|ref|NP_942214.1|
Domain Number - Region: 17-71
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0141
Family SinR domain-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|38505593|ref|NP_942214.1|
Sequence length 783
Comment hypothetical protein slr5058 [Synechocystis sp. PCC 6803]
Sequence
MAKRSLKASPDGQAQAKQAMLCRGWTQEYLAIEAGLSTRNSVWKFLTGRPVDRNIFMEIC
FQLDLDWQDIADLPTFPLEKVKATEPVDRPVTDESLKTTTIPDVPDLAIIKTKFKVLVDT
WCSRLPSYVDSNQSLLLTEVYVDVQVFPFAPDQQWLAQQNSLTGLRANTFSNQRLAPTSK
REQSVSALESVLQHNHVMVLGKPGTGKTLFLKYLALQCYGQSAGFDLLPIFVSLRSFVEF
IEAYENADLFSYLEHILRQAALSEAEVDYLFEQHKLLLLLNAFDEVSVEKADFVYQKIYQ
FTEKYHQNKIIISCRSASQNYYFQGFTHLELAGFSSPQIQQFTQRWFSATLQDSEQGEQK
AAQFLETLSRQDNQAIQELAHTPILLALLCSVFLARSEFPNKRSRLYQEALAILLTRWDQ
TRGIKRDQIYENLTLLDKLKLLSTIAAIAFEQGQYLIEQEELLQIILDFLSTLPNADDDL
DALWLNSETLLKEMEIQQGIIVQMAKGVYAFSHLTFQEYLTARKIVVDSTSEFPTLSLQE
LADHVMMPQWREVILLTVEMLPDPVKLLRLIQSQIDGLLRNDVGLQQFLQHVATKAESLD
VPYLSAAVRAFYLGLFCGRELNLASALDPKIVGDLAPDMALDLALLRVLHLGERLIEQPT
LEKLLELGFGLDLENRFTLTAPLLGSLHRLKQRLPASSQDLDTQLTWWQQEGHGWCEAWR
QMLIEQRGFGQPWQLTGSQQEKLEDYYQGNLFLLECLEQVTTRYRKAIAAQLLLPHDQGE
KVS
Download sequence
Identical sequences Q6ZES2
gi|38505593|ref|NP_942214.1|NC_005229 gi|451816601|ref|YP_007459804.1|NC_020296 WP_011153595.1.1889 WP_011153595.1.35395 gi|38505593|ref|NP_942214.1| 1148.slr5058 gi|38505593|ref|NP_942214.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]