SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|38505595|ref|NP_942216.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38505595|ref|NP_942216.1|
Domain Number 1 Region: 561-722
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.7e-41
Family Histidine kinase 0.00066
Further Details:      
 
Domain Number 2 Region: 934-1053
Classification Level Classification E-value
Superfamily CheY-like 1.04e-38
Family CheY-related 0.005
Further Details:      
 
Domain Number 3 Region: 308-479
Classification Level Classification E-value
Superfamily GAF domain-like 4.8e-32
Family GAF domain 0.0016
Further Details:      
 
Domain Number 4 Region: 493-573
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.16e-22
Family Homodimeric domain of signal transducing histidine kinase 0.0016
Further Details:      
 
Domain Number 5 Region: 1092-1205
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 4.84e-22
Family Sensor-like histidine kinase YojN, C-terminal domain 0.08
Further Details:      
 
Domain Number 6 Region: 774-895
Classification Level Classification E-value
Superfamily CheY-like 4.84e-18
Family CheY-related 0.0036
Further Details:      
 
Domain Number 7 Region: 169-298
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000454
Family Heme-binding PAS domain 0.042
Further Details:      
 
Domain Number 8 Region: 30-141
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000558
Family Heme-binding PAS domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|38505595|ref|NP_942216.1|
Sequence length 1209
Comment two-component hybrid sensor and regulator [Synechocystis sp. PCC 6803]
Sequence
MINSGTLITKIEELQSTLAKMDIALGTVDEAIVWTDGTGQIQWCNTAFDHLMGKLHILIL
GKNLVELLPLHRNSQPLEVSHHPFTIIVATQQKFTDHYEFNQNGKWLHLEIMTSPLMNAQ
GAVLVIRDISDRHLQEQTLQQLNENLEKRVLERTQAVSLINNKLEQELRERKKTEIALKA
TTSRLEALIQNLQAGVLVENENGKIVLVNQVFCDLFGIDVPPEKLIGFDCRQSAQFAKIL
FEDPEAFIIGIDNILQNRQIVTNEELRLKDGRTFARDYVPIEVGNHHDGRLWLYRNITPQ
KQAEVSLRKQYQRTLLLKEITEEIRQSLDPVKIFQVAVSRLGQTLQVSRCIVHLYSDMPQ
PHLTCVAEYLIPGMTSMLDLNLLIADNPHLLRALNQDDAVQVDNLKMVPTAVPLQDFYNQ
LQVYSLLIIRTSYQDKTNGLLILHQCDRSRSWNTEEVELVKAVADQVGIALAQAKLLEQE
REIRQQLIEQNKALMTATKAAEDANRAKSDFLATMSHEIRTPMNAVIGMTGLLLDTHLNT
QQQQFTETIRSSGEALLSLINDILDFSKIESGQFKLEIHPFEIQQCVEECLDLVAPQAFA
KKLDLVYQIEPQVPMAILGDLTRVRQVLVNILANAVKFTTSGSIQVRVSATVANQQQNKY
TIQFSIKDTGIGISPDQQSALFKSFSQVNTSIARKYGGTGLGLAICKRLTEMMGGQIWVE
SYGEIAGNPPVDWAKTSKNNPLESTGATFYFTITAQSTTIVRRPNDLSCQLSLAGKRLLI
VDDNQLSCEGLKQLVTAWGLQAQATTSGWEAFSWLRQGECFDLAIIDLQMEEVDGLQLAE
ALRTLPTGESLPLVILTPSPTSLAELSARTDISIAACLSSPIKKSLVYEVLCEVFKADET
DNSLFNGDWRSGITEAVKRTCSPQEREARIKTLSPLRILLVEDNNINQRVALLMLEKLGY
RPDIAGNGLEALQVLHQASYDVILMDVEMPEMDGLSATKAIRQDFPADEQPWIIAVTAYA
MQGDRETCLAAGMNDYITKPIRENDLLDALQRIDFSVLSLTKNKPAPLSEPVVNVGLVNP
VPEVLKADQLEENLVLDLSILTGIREMAGPDGATFLQVIIGDYLHTTPSLLEKLKTAIAA
QEIDTVRATAHSLGSSSANLGAVEFAKQCKQLENLARSGMLSGVDGQYIQLEKEYEKVSQ
ALALQLNPN
Download sequence
Identical sequences Q6ZES0
gi|38505595|ref|NP_942216.1| 1148.sll5060 gi|38505595|ref|NP_942216.1| WP_011153597.1.1889 WP_011153597.1.35395 gi|38505595|ref|NP_942216.1|NC_005229 gi|451816603|ref|YP_007459806.1|NC_020296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]