SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|38505606|ref|NP_942227.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38505606|ref|NP_942227.1|
Domain Number 1 Region: 6-58
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000106
Family POU-specific domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|38505606|ref|NP_942227.1|
Sequence length 114
Comment hypothetical protein slr5071 [Synechocystis sp. PCC 6803]
Sequence
MDDRDLVKIFKVKLSEQGIRQTEVCQEAGKPQSHLSKLLCGGKSPNLQTLLDFINATDRL
YPGFADQYWLAVAGRPTIRTLVDSMDSTELAVLLKVVGDRVAEAKLKAPMMEVA
Download sequence
Identical sequences Q6ZEQ9
1148.slr5071 gi|38505606|ref|NP_942227.1| gi|38505606|ref|NP_942227.1|NC_005229 gi|451816614|ref|YP_007459817.1|NC_020296 gi|38505606|ref|NP_942227.1| WP_011153608.1.1889 WP_011153608.1.35395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]