SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|38505613|ref|NP_942234.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38505613|ref|NP_942234.1|
Domain Number 1 Region: 127-306
Classification Level Classification E-value
Superfamily E set domains 1.4e-58
Family Cytoplasmic domain of inward rectifier potassium channel 0.000015
Further Details:      
 
Domain Number 2 Region: 35-155
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.58e-27
Family Voltage-gated potassium channels 0.0000602
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|38505613|ref|NP_942234.1|
Sequence length 312
Comment hypothetical protein slr5078 [Synechocystis sp. PCC 6803]
Sequence
MKFSFPWHWGKSHKLKPVTHPIRHLRPIQSGDSRQKKIQPMVTDLYHWLLVLSWPKFLAT
IGIFYFSLNVFFALIFSLTGDSIANAKPGSFLDLFFFSIQTLSTVGYGAMYPKTVAAQIV
VSVEIFVGLISLAILTGLMFSRFAKPTSRVLFSEVAVVCPFEEIPTLMFRAANQRNNRIL
EAQIRVSLVQDEQTKEGHKMRRFYDLNLLRSHTPVFGLSWLIMHPIDSNSPLYGFSEVSN
QQQRLELWISFTGLDESFSQTIHSRYAYEGADIRWQYRFVDIFHQTPEGKWFINMDNFHQ
IEPYHPKSPENS
Download sequence
Identical sequences Q6ZEQ2
gi|38505613|ref|NP_942234.1| WP_011153615.1.1889 WP_011153615.1.35395 gi|38505613|ref|NP_942234.1| gi|38505613|ref|NP_942234.1|NC_005229 gi|451816621|ref|YP_007459824.1|NC_020296 1148.slr5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]