SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|38505645|ref|NP_942266.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38505645|ref|NP_942266.1|
Domain Number 1 Region: 25-78
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000407
Family Probable transcriptional regulator VC1968, N-terminal domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|38505645|ref|NP_942266.1|
Sequence length 136
Comment hypothetical protein slr5110 [Synechocystis sp. PCC 6803]
Sequence
MLLREQPFNPHIKVYSRLSLLGKKMDFSEIFNQKLKHWRISGRALAVASGRSETNISQIR
NGVVSPSISDFQELIRICDDLKPGFASDYYSSLSPVAFSPEQFITHLDSSQLASLMSAIG
QRIKDYGRDAQFLKAS
Download sequence
Identical sequences Q6ZEM0
gi|38505645|ref|NP_942266.1| WP_011153647.1.1889 WP_011153647.1.35395 gi|38505645|ref|NP_942266.1| 1148.slr5110 gi|38505645|ref|NP_942266.1|NC_005229 gi|451816653|ref|YP_007459856.1|NC_020296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]