SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|38505706|ref|NP_942326.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38505706|ref|NP_942326.1|
Domain Number 1 Region: 31-90
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000113
Family GalR/LacI-like bacterial regulator 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|38505706|ref|NP_942326.1|
Sequence length 95
Comment hypothetical protein ssl7038 [Synechocystis sp. PCC 6803]
Sequence
METLKTIPWDAADHLESREDMAAYLEAALEEGDPALILVALGDIARSKGMTLIAKETGLG
RESLYKALSANGNPEFVTVLKVMEALGLRLQATTL
Download sequence
Identical sequences Q6ZEG0
1148.ssl7038 gi|38505706|ref|NP_942326.1| gi|38505706|ref|NP_942326.1|NC_005230 gi|451816709|ref|YP_007452976.1|NC_020287 gi|38505706|ref|NP_942326.1| WP_011153707.1.1889 WP_011153707.1.35395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]