SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|38505716|ref|NP_942336.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38505716|ref|NP_942336.1|
Domain Number 1 Region: 2-57
Classification Level Classification E-value
Superfamily AbrB/MazE/MraZ-like 0.000000453
Family AbrB N-terminal domain-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|38505716|ref|NP_942336.1|
Sequence length 73
Comment hypothetical protein ssl7048 [Synechocystis sp. PCC 6803]
Sequence
MLAKLTSKNQLTLPKSVTQQIGAAEYFEVTVQSGQIILTPVRIQRADAVRAKLALLDIIE
EDINNAVDWARQS
Download sequence
Identical sequences Q6ZEF0
gi|38505716|ref|NP_942336.1|NC_005230 gi|451816719|ref|YP_007452986.1|NC_020287 gi|38505716|ref|NP_942336.1| gi|38505716|ref|NP_942336.1| WP_011153717.1.1889 WP_011153717.1.35395 1148.ssl7048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]