SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|38505926|ref|NP_942544.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38505926|ref|NP_942544.1|
Domain Number 1 Region: 71-124
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000232
Family SinR domain-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|38505926|ref|NP_942544.1|
Sequence length 139
Comment hypothetical protein slr6101 [Synechocystis sp. PCC 6803]
Sequence
MSCTYLELIKSFPPRPIRSPEDFGATQAVVNNLLDKEVLTADEEDYLEVLGTLIYEYEQQ
QGDIIPDIHGTELLQILIEEYELKQKDLVPIFKTESIVSEVLKGKRQLTTRHIQELATFF
HVSPAVFFPANSSGDLLAA
Download sequence
Identical sequences Q6YRQ3
1148.slr6101 WP_011153895.1.1889 WP_011153895.1.35395 gi|38505926|ref|NP_942544.1|NC_005232 gi|451816889|ref|YP_007459977.1|NC_020297 gi|38505926|ref|NP_942544.1| gi|38505926|ref|NP_942544.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]