SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16329775|ref|NP_440503.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329775|ref|NP_440503.1|
Domain Number 1 Region: 39-188
Classification Level Classification E-value
Superfamily LexA/Signal peptidase 6.54e-55
Family Type 1 signal peptidase 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16329775|ref|NP_440503.1|
Sequence length 218
Comment leader peptidase I [Synechocystis sp. PCC 6803]
Sequence
MTENIVRETSKKKESPPENTWLELGKTMVTAVILAIGIRTFVAEARYIPSSSMEPTLQIN
DRLIIEKISYRLRDPERGEIVVFNPTDALKAKNFHDAFIKRIIGLPGDEVRVSQGNVYVN
GKMLDENYIAAPPAYEYGPVKVPDDQYLVLGDNRNNSYDSHYWGFVPREKLLGRAFVRFW
PVPRVGLLTDDAEREAVEISPQAWESPAISPQTVPESR
Download sequence
Identical sequences L8AHB8 P73157
gi|16329775|ref|NP_440503.1| gi|383321517|ref|YP_005382370.1| gi|383324687|ref|YP_005385540.1| WP_010871812.1.11876 WP_010871812.1.1889 WP_010871812.1.18904 WP_010871812.1.33690 WP_010871812.1.35395 WP_010871812.1.47586 WP_010871812.1.99424 1148.slr1377 gi|16329775|ref|NP_440503.1| gi|383490571|ref|YP_005408247.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]