SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16330028|ref|NP_440756.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330028|ref|NP_440756.1|
Domain Number 1 Region: 56-178
Classification Level Classification E-value
Superfamily Nudix 0.00000234
Family MutT-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16330028|ref|NP_440756.1|
Sequence length 210
Comment hypothetical protein sll1730 [Synechocystis sp. PCC 6803]
Sequence
MISIDKSYDRPWNEGQVLQIGSESARGNQPDAPAWTLLECFAEVKNPWLTLRGERWRDDR
ERKLDYWRVEKADSLIVLPQQGDRLLLPHPIFRPGIGRATWDFPGGRLTDLAKVELTLAE
ILHRELEVPPHAIAEITPLNDGGWAVNSSFSNQKLYGYWARIDGDFRLSPKAIGAEFQVP
SQLVDLLRILDCLQCRALLREWQQINTLFT
Download sequence
Identical sequences L8AGP5 P73396
gi|383324940|ref|YP_005385793.1| gi|383321771|ref|YP_005382624.1| 1148.sll1730 gi|16330028|ref|NP_440756.1| gi|383490824|ref|YP_005408500.1| gi|16330028|ref|NP_440756.1| WP_010872066.1.11876 WP_010872066.1.1889 WP_010872066.1.18904 WP_010872066.1.33690 WP_010872066.1.35395 WP_010872066.1.47586 WP_010872066.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]