SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16330447|ref|NP_441175.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330447|ref|NP_441175.1|
Domain Number 1 Region: 9-158
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.4e-34
Family Single-domain sulfurtransferase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16330447|ref|NP_441175.1|
Sequence length 179
Comment hypothetical protein slr1261 [Synechocystis sp. PCC 6803]
Sequence
MASSTQTNVTIAPKTLQQLRQQDAVILVDVREPLEFVGEHITDAYSLPLSRLNPSQLPQA
EGKTTVLYCQSSNRSGNALQQLRSAGVEGIIHLEGGLLAWKQAGLPTVKTKNAPISIMRQ
VQIIAGSLVLTGVLLGSFVAPGFYFLSGFVGAGLLFAGLSGTCMMANLLGKLPYNQIKD
Download sequence
Identical sequences L8AFV2 P73801
gi|16330447|ref|NP_441175.1| gi|383325357|ref|YP_005386210.1| gi|383491241|ref|YP_005408917.1| 1148.slr1261 gi|16330447|ref|NP_441175.1| WP_010872484.1.11876 WP_010872484.1.1889 WP_010872484.1.18904 WP_010872484.1.33690 WP_010872484.1.35395 WP_010872484.1.47586 WP_010872484.1.99424 gi|383322188|ref|YP_005383041.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]